PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0907s0070.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 400aa    MW: 45877.3 Da    PI: 7.4664
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0907s0070.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.12.9e-52451741129
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWk 84 
                             +ppGfrFhPtdeel+++yLkkkv+ +k+++ evi+evd++k+ePw+L++  ++ +  ++ewy F+++d+ky+tg+r+nrat++g+Wk
  SapurV1A.0907s0070.1.p  45 VPPGFRFHPTDEELLHYYLKKKVSFQKFDM-EVIREVDLNKMEPWELQEkcRIGSaPQNEWYLFCHKDRKYPTGSRTNRATNAGFWK 130
                             69****************************.99**************952433333556**************************** PP

                     NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                             atg+dk + + + +++g++ktLvfy grap+g+ktdW+mheyrle
  SapurV1A.0907s0070.1.p 131 ATGRDKCIRN-SYKKIGMRKTLVFYGGRAPHGQKTDWIMHEYRLE 174
                             *********9.8999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-5936196IPR003441NAC domain
PROSITE profilePS5100556.5645196IPR003441NAC domain
PfamPF023652.9E-2746173IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048829Biological Processroot cap development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MLFTHLYTQT FKELVNSNDR YFLQLDHQPN SCTSCMVMAT STGGVPPGFR FHPTDEELLH  60
YYLKKKVSFQ KFDMEVIREV DLNKMEPWEL QEKCRIGSAP QNEWYLFCHK DRKYPTGSRT  120
NRATNAGFWK ATGRDKCIRN SYKKIGMRKT LVFYGGRAPH GQKTDWIMHE YRLEDGDDDP  180
GNLGEDGWVV CRVFKKKNLF KVSSEGGSTS MNSSDQQVHS SSSNQSRTFM HRDSQYLLRQ  240
HHNHGNTQQP YEAELELHYP HMASPHQYSL FQSQTLIPTN KSLGYDYSGL HKESSAMVKQ  300
LMSNPRDCES GSESLRYHAC EPGLEVCTCE APQQMVAGRE DHLGLNKWAM LDRVVTSHLG  360
NDQDSSKGVR FDDASNAPST HPINQLSLRE EMNFWGYGK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-514519817167NO APICAL MERISTEM PROTEIN
1ut4_B4e-514519817167NO APICAL MERISTEM PROTEIN
1ut7_A4e-514519817167NO APICAL MERISTEM PROTEIN
1ut7_B4e-514519817167NO APICAL MERISTEM PROTEIN
3swm_A4e-514519820170NAC domain-containing protein 19
3swm_B4e-514519820170NAC domain-containing protein 19
3swm_C4e-514519820170NAC domain-containing protein 19
3swm_D4e-514519820170NAC domain-containing protein 19
3swp_A4e-514519820170NAC domain-containing protein 19
3swp_B4e-514519820170NAC domain-containing protein 19
3swp_C4e-514519820170NAC domain-containing protein 19
3swp_D4e-514519820170NAC domain-containing protein 19
4dul_A4e-514519817167NAC domain-containing protein 19
4dul_B4e-514519817167NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00431DAPTransfer from AT4G10350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010999502.10.0PREDICTED: protein BEARSKIN1
SwissprotQ9SV871e-152BRN2_ARATH; Protein BEARSKIN2
TrEMBLB9N1Q00.0B9N1Q0_POPTR; No apical meristem family protein
STRINGPOPTR_0019s09400.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87523343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G10350.11e-143NAC domain containing protein 70